DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment emc and Id2

DIOPT Version :9

Sequence 1:NP_523876.2 Gene:emc / 38091 FlyBaseID:FBgn0000575 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_037192.1 Gene:Id2 / 25587 RGDID:2859 Length:134 Species:Rattus norvegicus


Alignment Length:64 Identity:31/64 - (48%)
Similarity:43/64 - (67%) Gaps:9/64 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEM---------GNFDAAAALTAVN 98
            ||||:|||.:|:|:|:||:||:|||||||.|||..|::||.:         .|..:...||.:|
  Rat    44 SKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQTSRTPLTTLN 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emcNP_523876.2 HLH <37..80 CDD:238036 24/35 (69%)
Id2NP_037192.1 HLH <38..79 CDD:238036 24/34 (71%)
Nuclear export signal. /evidence=ECO:0000250 106..115 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337665
Domainoid 1 1.000 55 1.000 Domainoid score I10836
eggNOG 1 0.900 - - E1_2CI6V
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624054at2759
OrthoFinder 1 1.000 - - FOG0000920
OrthoInspector 1 1.000 - - otm45490
orthoMCL 1 0.900 - - OOG6_108505
Panther 1 1.100 - - O PTHR11723
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1045
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.