powered by:
Protein Alignment emc and Id4
DIOPT Version :9
Sequence 1: | NP_523876.2 |
Gene: | emc / 38091 |
FlyBaseID: | FBgn0000575 |
Length: | 199 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_112443.1 |
Gene: | Id4 / 15904 |
MGIID: | 99414 |
Length: | 161 |
Species: | Mus musculus |
Alignment Length: | 48 |
Identity: | 27/48 - (56%) |
Similarity: | 37/48 - (77%) |
Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 EMKMYLSKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEM 85
:|....|:|:.|||.:|.|:|::|:||:|||||||.|||..|||||.:
Mouse 67 DMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPAL 114
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167834119 |
Domainoid |
1 |
1.000 |
55 |
1.000 |
Domainoid score |
I11057 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1624054at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000920 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm43424 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11723 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4557 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1045 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
11 | 10.940 |
|
Return to query results.
Submit another query.