DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment emc and Id4

DIOPT Version :10

Sequence 1:NP_523876.2 Gene:emc / 38091 FlyBaseID:FBgn0000575 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_112443.1 Gene:Id4 / 15904 MGIID:99414 Length:161 Species:Mus musculus


Alignment Length:48 Identity:27/48 - (56%)
Similarity:37/48 - (77%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EMKMYLSKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEM 85
            :|....|:|:.|||.:|.|:|::|:||:|||||||.|||..|||||.:
Mouse    67 DMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPAL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emcNP_523876.2 bHLH_dnHLH_EMC_like 32..83 CDD:381538 25/44 (57%)
Id4NP_112443.1 bHLH_dnHLH_ID4 62..117 CDD:381537 27/48 (56%)

Return to query results.
Submit another query.