DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment emc and Id3

DIOPT Version :9

Sequence 1:NP_523876.2 Gene:emc / 38091 FlyBaseID:FBgn0000575 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_032347.1 Gene:Id3 / 15903 MGIID:96398 Length:119 Species:Mus musculus


Alignment Length:119 Identity:38/119 - (31%)
Similarity:56/119 - (47%) Gaps:16/119 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSLT-------AVCQTGASGMPALNASGRIQRHPTHRGDGENAEMKMYLSKLKDLVPFMPKNRK 58
            ||:|:       |||......:..  |.||.:...|........:|....|:|::|||.:|:..:
Mouse     1 MKALSPVRGCYEAVCCLSERSLAI--ARGRGKSPSTEEPLSLLDDMNHCYSRLRELVPGVPRGTQ 63

  Fly    59 LTKLEIIQHVIDYICDLQTELETHPEMGNFDA------AAALTAVNGLHEDEDS 106
            |:::||:|.|||||.|||..| ..|..|..|.      .|.||....:.:|:.|
Mouse    64 LSQVEILQRVIDYILDLQVVL-AEPAPGPPDGPHLPIQTAELTPELVISKDKRS 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emcNP_523876.2 HLH <37..80 CDD:238036 19/42 (45%)
Id3NP_032347.1 Interaction with IFI204. /evidence=ECO:0000250 35..87 20/52 (38%)
HLH <42..85 CDD:238036 20/43 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834118
Domainoid 1 1.000 55 1.000 Domainoid score I11057
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624054at2759
OrthoFinder 1 1.000 - - FOG0000920
OrthoInspector 1 1.000 - - otm43424
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11723
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.910

Return to query results.
Submit another query.