DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng3 and zgc:152938

DIOPT Version :9

Sequence 1:NP_612057.1 Gene:hng3 / 38090 FlyBaseID:FBgn0035160 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 / 768145 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio


Alignment Length:307 Identity:66/307 - (21%)
Similarity:117/307 - (38%) Gaps:95/307 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDMHRLIFEVQQRRALWDARHPDHANRPETQRLWNAVAEATGMDVELCRTKWKNLRCSYRRSNRR 65
            ||:..||..|..||.|:|..|.|:.:..:.:.||..:||..|..|:..:|||||||.:|.|..|.
Zfish    55 MDVEGLISLVSDRRELFDQNHIDYKHIDKREALWQEIAEKIGFHVDDVKTKWKNLRDTYIRKKRE 119

  Fly    66 ---SGILKHQQSPSPGHQWSYAEAMSFLDGQREECDNSNNGEEEMESALKIEAEHMPMLSTFKSE 127
               :|    :|:|.....|.:.:.|.||....|        :..:.|::|..|:.:         
Zfish   120 DQCTG----EQTPKKKKTWKFMKMMEFLATSSE--------QRRVHSSVKESADEV--------- 163

  Fly   128 QVSAADEMEADNDALMREFQNVSTPQALRRLSENISLASAAAEEQVPSTADQ----LSPNLNQGS 188
                .|..|::.                   |.:||:.||.:.|.|.:.:.:    ::|:.    
Zfish   164 ----GDGSESEK-------------------SLSISVESAVSSEPVQANSKKRKRSVTPDF---- 201

  Fly   189 AIAAAAASSCHCAKRVDEQVNFLESLEREEQQLMQSTSQDLARCKSVLHVGDSDYN-YLISFLPL 252
                           |::.:...|..:||.::..:...:|             |.: :|:|..|:
Zfish   202 ---------------VEKYLAAKEVRDREREECRKQRMED-------------DISLFLMSLAPV 238

  Fly   253 MKQMTP---------FQNVFFRAKMGELLLQTMQQPPVQQQPQQQQQ 290
            ::::.|         |..|....:.|  |....|.|..|..|:...:
Zfish   239 IRRLPPSKQSSVKMRFHQVLHEVEYG--LSDASQPPSAQHCPESNHR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng3NP_612057.1 MADF 5..91 CDD:214738 31/88 (35%)
BESS 240..274 CDD:281011 9/43 (21%)
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 27/71 (38%)
BESS 226..260 CDD:281011 8/46 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.