DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng3 and si:ch211-207i20.3

DIOPT Version :9

Sequence 1:NP_612057.1 Gene:hng3 / 38090 FlyBaseID:FBgn0035160 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 / 555734 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio


Alignment Length:291 Identity:74/291 - (25%)
Similarity:117/291 - (40%) Gaps:81/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDMHRLIFEVQQRRALWDARHPDHANRPETQRLWNAVAEATGMDVELCRTKWKNLRCSYRRSNR- 64
            ||...|:|.|.:.:.|:|..|.::.|....:.||..:|:..|:|||..:.||||||.:|.|..| 
Zfish    30 MDAELLLFLVSENKELFDKNHSEYKNTKRKEALWQGIADKMGVDVEEVKAKWKNLRDTYTRKKRL 94

  Fly    65 -----RSGILKHQQSPSPGHQWSYAEAMSFLDGQREECDNSNNGEEEMESALKIEAEHMPMLSTF 124
                 |||     ::.....||.|...|.|||.                     ..||...:...
Zfish    95 EQDGSRSG-----RAAKKKKQWKYMRVMDFLDP---------------------ATEHRSGILDS 133

  Fly   125 KSEQVSAADEMEADNDALMREFQ---NVSTPQAL------RRLSENISLASAAAEEQVPSTADQL 180
            |.|.    ||.:.|:.|......   :|::|:|:      ||.||.:.|.     |:..:|.|..
Zfish   134 KIED----DEPDEDSGAEPASTSTGTSVTSPEAMRSSIVKRRRSETLELL-----EKYLATKDAK 189

  Fly   181 SPNLNQGSAIAAAAASSCHCAKRVDEQVNFLESLEREEQQLMQSTSQDLAR--CKSVLHVGDSDY 243
            ....::               ::.||...||.||....::| .::.|.|.:  .:.:||  |:::
Zfish   190 DREKDE---------------QQQDEVDLFLRSLAPALRRL-PASKQSLVKLQIQKILH--DAEF 236

  Fly   244 NYLISFLPLMKQMTPFQNVFFRAKMGELLLQ 274
            .. .|| |.:..::|         ..:||||
Zfish   237 GQ-PSF-PQISSVSP---------SNQLLLQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng3NP_612057.1 MADF 5..91 CDD:214738 31/91 (34%)
BESS 240..274 CDD:281011 7/33 (21%)
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 32/91 (35%)
BESS 199..233 CDD:308542 11/36 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 1 1.000 - - oto39613
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17135
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.