DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng3 and Dlip3

DIOPT Version :9

Sequence 1:NP_612057.1 Gene:hng3 / 38090 FlyBaseID:FBgn0035160 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_525003.2 Gene:Dlip3 / 53579 FlyBaseID:FBgn0040465 Length:348 Species:Drosophila melanogaster


Alignment Length:341 Identity:74/341 - (21%)
Similarity:120/341 - (35%) Gaps:82/341 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLIFEVQQRRALWDARHPDHANRPETQRLWNAVAEATGMDVELCRTKWKNLRCSYRRSNRRSGIL 69
            |||..|:...|::|..||.:...|....:|:.:|...|......:|||||:|.:|.:..:  .|.
  Fly    34 RLIKLVRANPAIYDVSHPHYRRNPVRVDIWDRIANELGASSRFLQTKWKNIRYNYLQEVK--AIE 96

  Fly    70 KHQQSPSPGHQWSYAEAMSFLDGQREECD-----------NSNNGEEEMESALKIEAEHMPMLST 123
            ..|.:|:. .:..:.|.:|||....:..:           |....:.:..|.|..:.||:     
  Fly    97 TGQANPNV-RKRRFTEDLSFLQNTAQTYNVKKSQSYVAQQNGMGSDNDSNSFLYPDPEHL----- 155

  Fly   124 FKSEQVSAADEMEADN-DALMREFQNVSTPQALRRLSENISLASAAAEEQVPSTADQLSPNLNQG 187
             |.:.....|.:|.|| |.......|...|:        :.|....:::|:     .|...||  
  Fly   156 -KIDASEGYDIIELDNSDDGSNSDDNEIVPE--------LQLVMGESKQQL-----SLPTTLN-- 204

  Fly   188 SAIAAAAASSCHCAKRVDEQVNFLESLEREEQQLMQSTSQDLARCKSVLHVGDSDYNYLISFLPL 252
                 ..:||.|               ..|..|.....|..|.....|:..|   |...:.   |
  Fly   205 -----GTSSSNH---------------SHEHDQASSPASSPLLTPMVVMGNG---YGQEVH---L 243

  Fly   253 MKQMTPFQNVFFRAKM--GELLLQTMQQPPVQQQPQQQQQLQLQLQQQPEQRQQQQQPSQMLLNQ 315
            .:|.|..|..|..:.:  ||:.::     |:.:....::.|.......|.:|:..|.|.      
  Fly   244 EQQQTQEQKPFKNSSLSNGEVTIE-----PIYKPAAIRRALPSDFLTNPFKRKATQAPL------ 297

  Fly   316 QQMALDQAQVSTSSTN 331
                  |.|| |||.|
  Fly   298 ------QTQV-TSSFN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng3NP_612057.1 MADF 5..91 CDD:214738 25/85 (29%)
BESS 240..274 CDD:281011 8/35 (23%)
Dlip3NP_525003.2 MADF 34..118 CDD:214738 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.