DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng3 and Adf1

DIOPT Version :9

Sequence 1:NP_612057.1 Gene:hng3 / 38090 FlyBaseID:FBgn0035160 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:297 Identity:55/297 - (18%)
Similarity:111/297 - (37%) Gaps:69/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIFEVQQRRALWDARHPDHANRPETQRLWNAVAEATGMDVELCRTKWKNLRCSYRRSNRRSGILK 70
            ||..|:....::|..|.::.:.....:.|..:||..|:..:.|..:||:||..:.|..:..    
  Fly    16 LIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLC---- 76

  Fly    71 HQQSPSPGHQWSYAEAMSFL-DGQRE-------ECDN-SNNGEEEMESALKIEAEHMPMLSTFKS 126
             |:|     :|.|.:.|.|| |..|:       :|.| |.:..:..:.:.:.:|:...::..|  
  Fly    77 -QES-----RWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVDIF-- 133

  Fly   127 EQVSAADEMEADNDALMREFQNVSTPQALRRLSENISLASAAAEEQVP----------STADQLS 181
                    .:..|.:.....|.::.|..: .::.:..||:|..::|.|          .:.::.|
  Fly   134 --------AQPFNGSATTSAQALTHPHEI-TVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHS 189

  Fly   182 PN-LN-----QGSAIAAAAASSCHCAKRVDEQVNFLESLEREEQQLMQSTSQDLARCKSVLHVGD 240
            .| ||     |.:...|.:|........|.:.:|.|...::.|.::                   
  Fly   190 DNMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKV------------------- 235

  Fly   241 SDYNYLISFLPLMKQMTPFQNVFFRAKMGELLLQTMQ 277
                ::|.:|..|:.:...... ........|||.:|
  Fly   236 ----HIIKYLTDMQLLAQHNKYXLSGGCHRQLLQLLQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng3NP_612057.1 MADF 5..91 CDD:214738 22/85 (26%)
BESS 240..274 CDD:281011 4/33 (12%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D98646at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.