DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng3 and hng2

DIOPT Version :9

Sequence 1:NP_612057.1 Gene:hng3 / 38090 FlyBaseID:FBgn0035160 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster


Alignment Length:288 Identity:58/288 - (20%)
Similarity:101/288 - (35%) Gaps:75/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MHRLIFEVQQRRALWDARHPDHANRPETQRLWNAVAEATGMDVELCRT----------------- 50
            |:..|..|.:|..:|:..||:..||......|..:..      |||..                 
  Fly    18 MYEFIDAVHKRSIIWERSHPNFHNRELRDEAWQQIGH------ELCSNFDDSSEPEKQEIVKTLL 76

  Fly    51 -KWKNLRCSYRRSNRRSGILKHQQSPSPGHQWSYAEAMSFLDGQREECDNSNNGEEEMESALKIE 114
             :|||.|.||.|.||    |:..........:.|.:.:|||...:.|      .|:::||   ::
  Fly    77 KRWKNTRDSYLRVNR----LRQSGEEVARASYIYEKELSFLLNVKAE------SEDDVES---LK 128

  Fly   115 AEHMPMLSTFKSEQVSAADEMEADNDALMREFQNVSTPQALRRLSENISLASAAAEEQVPSTADQ 179
            .:..|..   |.::||.|.:..|            .||:. |...:..::..|.....:||..:.
  Fly   129 EQPKPQA---KRKRVSTAAQRSA------------KTPRK-RNSDQESNIEPAIRNPAIPSNINT 177

  Fly   180 LSPNLNQGSAIAAAAASSCHCAKRVDEQVNFLESLEREEQQLMQSTSQDLARCKSVLHVGDSDYN 244
            :..:|.              |||.        ::...|...:.|..|.......:.....|.|..
  Fly   178 VLGDLG--------------CAKE--------DTATPEIAYIPQLPSDPPCSTNTAYLSADPDQA 220

  Fly   245 YLISFLPLMKQMTPFQNVFFRAKMGELL 272
            :..:..|.|:||...:.:.|:.::.::|
  Fly   221 FFDTIKPHMQQMCADRKLDFQIEVLKIL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng3NP_612057.1 MADF 5..91 CDD:214738 25/103 (24%)
BESS 240..274 CDD:281011 8/33 (24%)
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 24/101 (24%)
BESS 216..250 CDD:281011 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.