DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng3 and CG12609

DIOPT Version :9

Sequence 1:NP_612057.1 Gene:hng3 / 38090 FlyBaseID:FBgn0035160 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_728194.1 Gene:CG12609 / 32862 FlyBaseID:FBgn0030952 Length:324 Species:Drosophila melanogaster


Alignment Length:191 Identity:33/191 - (17%)
Similarity:77/191 - (40%) Gaps:9/191 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLIFEVQQRRALWDARHPDHANRPETQRLWNAVAEATG--MDVELCRTKWKNLRCSYRRSNRRSG 67
            ||:...:::..||....|.:.:....:..|..:|...|  :..|..|.:.:|:|  |:.:..:..
  Fly    34 RLVDLYREQPCLWKITLPAYKDADMKRSSWEKIASQLGSHLSAEFIRCRMRNMR--YQLNVYKLQ 96

  Fly    68 ILKHQQSP---SPGHQWSYAEAMSFLDGQ--REECDNSNNGEEEMESALKIEAEHMPMLSTFKSE 127
            ::::|.:.   .|..:..|.:..:||:.:  .||.||..:.....:..:........:.|.|..:
  Fly    97 MIEYQMTSGKGKPPEKPYYVDRFAFLEQEDGAEESDNQQSNANAKKQNIPRSERFAKLWSDFNLK 161

  Fly   128 QVSAADEMEADNDALMREFQNVSTPQALRRLSENISLASAAAEEQVPSTADQLSPNLNQGS 188
            .::..:..:|.:....|..|.::....:|..::...||......::|.....:....|.|:
  Fly   162 SMTKRESTDASSKESHRSGQRIADMVKMRMDAQVGPLAFDRPRLKIPDFKQNIIWKRNLGN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng3NP_612057.1 MADF 5..91 CDD:214738 17/90 (19%)
BESS 240..274 CDD:281011
CG12609NP_728194.1 MADF_DNA_bdg 35..122 CDD:287510 15/88 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.