Sequence 1: | NP_612057.1 | Gene: | hng3 / 38090 | FlyBaseID: | FBgn0035160 | Length: | 333 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500389.2 | Gene: | madf-9 / 191167 | WormBaseID: | WBGene00022608 | Length: | 333 | Species: | Caenorhabditis elegans |
Alignment Length: | 293 | Identity: | 56/293 - (19%) |
---|---|---|---|
Similarity: | 107/293 - (36%) | Gaps: | 70/293 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 RLIFEVQQRRALWDARHPDHANRPETQRLWNAVAEATGMDVELCRTKWKNLRCSYRRSNRRSGIL 69
Fly 70 KHQQSPSPGHQWSYAEAMSFLDGQREECDNSNNGEEEMESALKIEAE-HM-PM---LSTFKSEQV 129
Fly 130 SAADEMEADNDALMREFQNVST----------------------------PQALRRLSENISLAS 166
Fly 167 ---AAAEEQVPSTADQLSPNLNQGSAIAAAAASSCHCAKRVDEQVNFLESL-------EREEQQL 221
Fly 222 -----------MQSTSQDLARCKSVLHVGDSDY 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hng3 | NP_612057.1 | MADF | 5..91 | CDD:214738 | 23/85 (27%) |
BESS | 240..274 | CDD:281011 | 1/4 (25%) | ||
madf-9 | NP_500389.2 | MADF | 52..136 | CDD:214738 | 23/89 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |