DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng3 and madf-10

DIOPT Version :9

Sequence 1:NP_612057.1 Gene:hng3 / 38090 FlyBaseID:FBgn0035160 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_492729.1 Gene:madf-10 / 190925 WormBaseID:WBGene00013717 Length:234 Species:Caenorhabditis elegans


Alignment Length:190 Identity:38/190 - (20%)
Similarity:72/190 - (37%) Gaps:28/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VQQRRALWDARHPDHANRPETQRLWNAVAEATG--------MDVELCRTKWKNLRCSYRRSNRRS 66
            :..|..|||:.. :..:....:.|:..|.|...        :.:|.....||||:.:|.:: ||.
 Worm    57 IAHRPGLWDSTR-EKVSSAARKNLFAEVVEVINQQFVLSPPLTIEEIEKHWKNLKDTYVKT-RRK 119

  Fly    67 GILKHQQSP-SPGHQWSYAEAMSFLDGQREECDNSNNGEEEMESALKIEAEHMPM-LSTFKSEQV 129
            ....|...| .|  :|.:.:::.|||        |.|..:.:.....::.:..|. |....|.:.
 Worm   120 LTFDHDGCPIRP--KWKFFDSLMFLD--------SVNQNDFVMKKRPMQFQGQPYDLYQGPSSKK 174

  Fly   130 SAADEMEADN-----DALMREFQNVSTPQALRRLSENISLASAAAEEQVPSTADQLSPNL 184
            ...:||.:|.     .:|....:.:.....:..|....|:.....|.|:.|.. :.:|:|
 Worm   175 EKLEEMPSDEYMEFCRSLYLPLKEIGYKDRIHWLKIQKSIRDIVYEAQLESVT-KAAPDL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng3NP_612057.1 MADF 5..91 CDD:214738 20/89 (22%)
BESS 240..274 CDD:281011
madf-10NP_492729.1 MADF 53..147 CDD:214738 23/101 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.