DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng3 and madf-4

DIOPT Version :9

Sequence 1:NP_612057.1 Gene:hng3 / 38090 FlyBaseID:FBgn0035160 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_505565.3 Gene:madf-4 / 179386 WormBaseID:WBGene00011575 Length:329 Species:Caenorhabditis elegans


Alignment Length:357 Identity:67/357 - (18%)
Similarity:125/357 - (35%) Gaps:104/357 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIFEVQQRRALWDARHPDHANRPETQRLWNAVAEATGMD---VELCRTKWKNLRCSYRRSNRRSG 67
            ||..||:...:::...|.|........:|..::...|.|   |||.| |||::|..|.|..::. 
 Worm    22 LIDSVQRNPCVYNRYDPLHKVTDYKHEIWKLISIEIGYDGQPVELER-KWKHMRDKYVRLRKQD- 84

  Fly    68 ILKHQQSP-SPGHQW-SYAEAMSFLDGQREECDNSNNGEEEMESALKIEAEHMPMLSTFKSEQVS 130
               .|::| ...::| :|...|||||..                     .||.            
 Worm    85 ---KQKAPIKKTNKWYNYYHKMSFLDPY---------------------VEHR------------ 113

  Fly   131 AADEMEADNDALMREFQNVSTPQAL---RRLSENISLASAAAEEQVPSTAD--QLSPNLNQGSAI 190
                    |....:::.|.:||..|   ....:.:|:......|.:.::.|  ..||:....|:.
 Worm   114 --------NRKRQKDYLNSNTPDFLDDDTAFLDGLSVKEMLKPESLLTSNDAGYNSPHTTSSSSS 170

  Fly   191 AAAAASSCHCAKRVDEQVNFLES----LEREEQQLMQSTSQDLARCKSVLHVGDSDYNYLISFLP 251
            :.:           :....||:|    :|.:::.|.      |...|.|.:..:::.|:..|...
 Worm   171 SGS-----------NNNGRFLDSPTIDIEDDKKNLA------LIYDKFVANQTENEKNHRFSNKH 218

  Fly   252 LMKQMTPFQNVFFRAKMGELLLQTMQQP---------PVQ----QQPQQQQQLQLQLQQQPEQRQ 303
            ....:....|...     |.|..|...|         |||    ..|.|::..:::|.:......
 Worm   219 GKDLLFSTTNTLI-----EKLATTSTAPSSSRKRKPIPVQILPSSPPPQEKNTKIELLEDILNEP 278

  Fly   304 QQQQPSQML---------LNQQQMALDQAQVS 326
            .:.|.|..:         |::::.|:.:.::|
 Worm   279 NEDQVSLFVRSIARTLNDLDREKFAMARVEIS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng3NP_612057.1 MADF 5..91 CDD:214738 26/89 (29%)
BESS 240..274 CDD:281011 5/33 (15%)
madf-4NP_505565.3 MADF 22..111 CDD:214738 28/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17135
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.