DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13895 and CG13894

DIOPT Version :9

Sequence 1:NP_001261220.1 Gene:CG13895 / 38087 FlyBaseID:FBgn0035158 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_612054.1 Gene:CG13894 / 38086 FlyBaseID:FBgn0035157 Length:528 Species:Drosophila melanogaster


Alignment Length:541 Identity:108/541 - (19%)
Similarity:176/541 - (32%) Gaps:218/541 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 MQLDGFV-PNKPWINHFKAAYNITLSNRQITIVRRPPRSMDLRDIMSYCGRHTSMSCSLAPRSPE 197
            ||...|. |..|:...:|.|.:.:|  |:|...::|          ..|..|...|.....|   
  Fly    22 MQFFAFPRPENPFHKLWKEACHASL--RRIVPFKKP----------VVCALHFDPSVLGGRR--- 71

  Fly   198 PALTSSDRPLYRTKTLVTTSS-QNQATSDEVHLRRKRKLAFLEKCVYEYIQRSQLVRQ--GRLDL 259
              |.|:..|..|.:......: :.||..:|:  .|.||.|::...|||::.|:.:..|  |.:..
  Fly    72 --LQSNALPTLRLEVPSNLEAVEQQAMVEEI--ERSRKCAYINAVVYEWLVRANINPQLRGSITH 132

  Fly   260 DNLRFVAISLRDILKIDSFFPDKVWLKHFKSRYNFNFTVGVQVTNRRLPL--SLDLRDIVSYCGR 322
            ..::..|.:.|.::...||..|..||..|:..:...|...: .:|:..||  ||.:.|||     
  Fly   133 GMIKDKAENARQVIGSTSFIADNRWLNRFRETHLQGFAQKL-ASNQLKPLGSSLWIPDIV----- 191

  Fly   323 NEHKITLDHKKSQEELSQSDKP-EVDQCPQVEPKPEEF--------EHEEDDDCVAIE------- 371
                         ::|:....| ..::..::|..||::        |:|||||.:.::       
  Fly   192 -------------QDLAHLFPPASAERVAKLEEMPEQYMTYMQQYGEYEEDDDSMDVKEQSYQEQ 243

  Fly   372 ----------------------------------------------------------------- 371
                                                                             
  Fly   244 QQQQQQHFALQQQHMQQQQHQMGHPWPPFPGHPGHPTPHPGFASFNDFYFERHQQQMQQQLQQQQ 308

  Fly   372 -----------------------VPPE--------------LIEIKDDED--------------- 384
                                   |||:              .:|..||::               
  Fly   309 QMQQFPPTMPPQREPFQPQLPPNVPPQRASPFQPVQLAKRPKMESPDDDEVQEINSAVNSPPYPL 373

  Fly   385 ---------------NDDEHNDNEDLPERATKRKSDENGG----------------PIPCGLKIQ 418
                           |:..:|::......::|..:.:.||                |.|......
  Fly   374 AESTLTSKHSRSSSPNEQNNNNSGGRDSASSKENAPKGGGTSGKSTPALSSKGKDSPAPARAAST 438

  Fly   419 KIQSLNES---LPEDTELLPANSPGHYS-ETSDEAHLPRC----VESYKDALRLLKPLEEFVLME 475
            |..|...|   :|..:....:.:.||.| :..|:..|  |    :|||..||..|||||:|||.:
  Fly   439 KPASAPASPKKIPNGSSSSGSQTNGHTSPDPEDKKAL--CMLKELESYHQALEYLKPLEDFVLFK 501

  Fly   476 ENYRAIGLLTQLEKIFESAAK 496
            ||:||||||:|||.:.....|
  Fly   502 ENFRAIGLLSQLELVLRKGDK 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13895NP_001261220.1 HTH 24..74 CDD:304362
CENPB 93..159 CDD:197828 8/25 (32%)
CENPB 232..298 CDD:197828 18/67 (27%)
CG13894NP_612054.1 THAP 6..82 CDD:214951 18/76 (24%)
CENPB 104..165 CDD:197828 17/60 (28%)
NST1 382..>468 CDD:290656 14/85 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F66R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014353
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.