DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13894 and THAP3

DIOPT Version :9

Sequence 1:NP_612054.1 Gene:CG13894 / 38086 FlyBaseID:FBgn0035157 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_001381425.1 Gene:THAP3 / 90326 HGNCID:20855 Length:246 Species:Homo sapiens


Alignment Length:287 Identity:56/287 - (19%)
Similarity:101/287 - (35%) Gaps:73/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RRCCIIGCLSNSRQHPSMQFFAFPRPENPFHKLWKE-ACHASLRRIVPFKKPVVCALHFDP---S 65
            |:||  ...|:.|:..:...|.|.|||     |.|| ..:.......|.:..|:|:.||.|   |
Human     8 RQCC--NRYSSRRKQLTFHRFPFSRPE-----LLKEWVLNIGRGNFKPKQHTVICSEHFRPECFS 65

  Fly    66 VLGGRR-LQSNALPTL------RLEVPSNLEAVEQQ--AMVEEIERSRKCAYINAVVYEWLVRAN 121
            ..|.|: |:.||:||:      ..:|..|.:...::  |...:.|::..|            |:.
Human    66 AFGNRKNLKHNAVPTVFAFQDPTQQVRENTDPASERGNASSSQKEKTSPC------------RSQ 118

  Fly   122 INPQL-RGSITHGMIKDKAENARQVIGSTSFIADNRWLNRFRETHLQGFAQKLASNQLKPLGSSL 185
            :.|:. .|..:.|...|.|....|:                 ..:.:|..::::..:        
Human   119 VLPEAGAGEDSPGRNMDTALEELQL-----------------PPNAEGHVKQVSPRR-------- 158

  Fly   186 WIPDIVQDLAHLFPPASAERVAKLEEMPEQYMTYMQQYGEYEEDDDSMDVKEQSYQEQQQQQQQH 250
              |...:.:.....||...|....:.....|...         |.||:  |::.:...::.::..
Human   159 --PQATEAVGRPTGPAGLRRTPNKQPSDHSYALL---------DLDSL--KKKLFLTLKENEKLR 210

  Fly   251 FALQQQHMQQQQHQMGHPWPPFPGHPG 277
            ..||.|.:..:  :|........||.|
Human   211 KRLQAQRLVMR--RMSSRLRACKGHQG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13894NP_612054.1 THAP 6..82 CDD:214951 26/86 (30%)
CENPB 104..165 CDD:197828 8/61 (13%)
NST1 382..>468 CDD:290656
THAP3NP_001381425.1 THAP 4..82 CDD:214951 27/80 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.