DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13894 and LOC798124

DIOPT Version :9

Sequence 1:NP_612054.1 Gene:CG13894 / 38086 FlyBaseID:FBgn0035157 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_001373707.1 Gene:LOC798124 / 798124 -ID:- Length:437 Species:Danio rerio


Alignment Length:192 Identity:44/192 - (22%)
Similarity:74/192 - (38%) Gaps:51/192 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPTIRRCCIIGCL--SNSRQHPSMQFFAFPRPENPFHKLWKEACHASLRR--IVPFKKPVVCALH 61
            ||   :||:..||  |.|:|...:.|:.||..|....| |.:    |:||  ..|.....||:.|
Zfish     1 MP---QCCVPCCLNRSESKQLKKLSFYRFPCDEKQKRK-WLQ----SIRRKNFYPNCNSRVCSWH 57

  Fly    62 F-DPSVLGGRRLQSNALPTLRLEVPSN--LEAVEQQAMVEEI---ERSRKCA--YINAVVYEWLV 118
            | :....|..|...|.....:...|.:  .:..||...|:.|   :|:::.|  ..:.||.:   
Zfish    58 FPNGKAAGPSRFAWNEAKVFQFPDPQSHTSKKREQSPPVDSIADRQRTKEMATQTPSTVVLQ--- 119

  Fly   119 RANINPQLRGSITHGMIKDKAENARQVIGSTSFIADNRWLNRFRETHLQGFA-QKLASNQLK 179
                       :.:.::|                .:|..|.:..||..|.|: .:::||..:
Zfish   120 -----------VENDILK----------------KENEMLRKQLETQKQTFSFNQISSNSAR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13894NP_612054.1 THAP 6..82 CDD:214951 24/80 (30%)
CENPB 104..165 CDD:197828 7/62 (11%)
NST1 382..>468 CDD:290656
LOC798124NP_001373707.1 THAP 5..>58 CDD:398893 18/57 (32%)
HTH_Tnp_4 188..238 CDD:404497
DDE_Tnp_4 271..427 CDD:404270
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.