DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13894 and Thap2

DIOPT Version :9

Sequence 1:NP_612054.1 Gene:CG13894 / 38086 FlyBaseID:FBgn0035157 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_001381922.1 Gene:Thap2 / 688019 RGDID:1593643 Length:217 Species:Rattus norvegicus


Alignment Length:273 Identity:58/273 - (21%)
Similarity:96/273 - (35%) Gaps:95/273 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPTIRRCCIIGCLSNSRQHPSMQFFAFP-RPENPFHKLWKEACHASLRRIVPFKKPVVCALHFDP 64
            |||  .|...||.:...:|.::.|..|| .|:.  .|.|......  :..||.|...:|:.||:.
  Rat     1 MPT--NCAAAGCAATYNKHINISFHRFPLDPKR--RKEWVRLVRR--KNFVPGKHTFLCSKHFEA 59

  Fly    65 SV--LGG--RRLQSNALPT----------LRLEV--------------PSNLEA-VEQQAMVEEI 100
            |.  |.|  |||:.:|:||          |:|:.              |.||:. ..||.::|  
  Rat    60 SCFDLTGQTRRLKMDAVPTIFDFCTHIKSLKLKSRNLLKKSNSFTSAGPCNLKLNSSQQVLLE-- 122

  Fly   101 ERSRKCAYINAVVYEWLVRANINPQLR--------GSITHGMIKDKAENARQVIGSTSFIADNRW 157
                         :.:..|:.:..:.|        .|:...| |...:..|:        |..||
  Rat   123 -------------HSYAFRSPVEAKKRIIKLEREIASLRRKM-KTCLQRERR--------ATRRW 165

  Fly   158 LNRFRETHLQGFAQKLASNQLKPLGSSLWIPDIVQDLAHLFPPASAERVAKLEEMPEQYMTYMQQ 222
            :.      ...|.:.|.:..:.|.|.|          ..:.|.|       |..:|.:.:..:||
  Rat   166 IK------ATCFVKSLEAGNMLPKGIS----------EQILPTA-------LSSLPLENLKILQQ 207

  Fly   223 YGEYEEDDDSMDV 235
                ::.|.::.|
  Rat   208 ----DQQDKTLPV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13894NP_612054.1 THAP 6..82 CDD:214951 26/90 (29%)
CENPB 104..165 CDD:197828 9/68 (13%)
NST1 382..>468 CDD:290656
Thap2NP_001381922.1 THAP 6..80 CDD:398893 24/77 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.