DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13894 and Thap2

DIOPT Version :9

Sequence 1:NP_612054.1 Gene:CG13894 / 38086 FlyBaseID:FBgn0035157 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_080056.1 Gene:Thap2 / 66816 MGIID:1914066 Length:217 Species:Mus musculus


Alignment Length:266 Identity:56/266 - (21%)
Similarity:104/266 - (39%) Gaps:81/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPTIRRCCIIGCLSNSRQHPSMQFFAFP-RPENPFHKLWKEACHASLRRIVPFKKPVVCALHFDP 64
            |||  .|...||.:...:|.::.|..|| .|:.  .|.|......  :..||.|...:|:.||:.
Mouse     1 MPT--NCAAAGCAATYNKHINISFHRFPLDPKR--RKEWVRLVRR--KNFVPGKHTFLCSKHFEA 59

  Fly    65 SV--LGG--RRLQSNALPTLRLEVPSNLEAVEQQAMVEEIERSRKCAYINAVVYEWLVRAN---- 121
            |.  |.|  |||:.:|:||: .:..:::::::.        :||.           |::.|    
Mouse    60 SCFDLTGQTRRLKMDAVPTI-FDFCTHIKSLKL--------KSRN-----------LLKTNNSFP 104

  Fly   122 ----INPQLRGS----ITHG-MIKDKAENARQVIGSTSFIADNRWLNRFRETHLQG--------- 168
                .|.:|.||    :.|. ..::..|..:::|.....||.   |.:..:|.||.         
Mouse   105 PTGPCNLKLNGSQQVLLEHSYAFRNPMEAKKRIIKLEKEIAS---LRKKMKTCLQRERRATRRWI 166

  Fly   169 ----FAQKLASNQLKPLGSSLWIPDIVQDLAHLFPPASAERVAKLEEMPEQYMTYMQQYGEYEED 229
                |.:.|.::.:.|.|.|          ..:.|.|       |..:|.:.:..::|    ::.
Mouse   167 KATCFVKSLEASNMLPKGIS----------EQILPTA-------LSNLPLEDLKSLEQ----DQQ 210

  Fly   230 DDSMDV 235
            |.::.:
Mouse   211 DKTVPI 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13894NP_612054.1 THAP 6..82 CDD:214951 25/80 (31%)
CENPB 104..165 CDD:197828 13/73 (18%)
NST1 382..>468 CDD:290656
Thap2NP_080056.1 THAP 4..82 CDD:283206 25/82 (30%)
HCFC1-binding motif (HBM). /evidence=ECO:0000250 122..125 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.