DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13894 and THAP1

DIOPT Version :10

Sequence 1:NP_612054.1 Gene:CG13894 / 38086 FlyBaseID:FBgn0035157 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_060575.1 Gene:THAP1 / 55145 HGNCID:20856 Length:213 Species:Homo sapiens


Alignment Length:85 Identity:23/85 - (27%)
Similarity:37/85 - (43%) Gaps:10/85 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRRCCIIGCLSNSRQHPSMQFFAFPRPENPFHKLWKEACHASLRR--IVPFKKPVVCALHFDPSV 66
            ::.|...||.:...:...:.|..||.......|.|:    |::||  ..|.|...:|:.||.|..
Human     2 VQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWE----AAVRRKNFKPTKYSSICSEHFTPDC 62

  Fly    67 L----GGRRLQSNALPTLRL 82
            .    ..:.|:.||:||:.|
Human    63 FKRECNNKLLKENAVPTIFL 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13894NP_612054.1 THAP 6..82 CDD:214951 22/81 (27%)
CENPB 104..165 CDD:197828
THAP1NP_060575.1 THAP 4..82 CDD:214951 22/81 (27%)
HCFC1-binding motif (HBM) 134..137
Involved in homodimer formation. /evidence=ECO:0000269|PubMed:28299530 139..185
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.