powered by:
Protein Alignment CG13894 and Arl14epl
DIOPT Version :9
Sequence 1: | NP_612054.1 |
Gene: | CG13894 / 38086 |
FlyBaseID: | FBgn0035157 |
Length: | 528 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001028618.1 |
Gene: | Arl14epl / 381142 |
MGIID: | 2685795 |
Length: | 152 |
Species: | Mus musculus |
Alignment Length: | 71 |
Identity: | 15/71 - (21%) |
Similarity: | 37/71 - (52%) |
Gaps: | 2/71 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 192 QDLA-HLFPPASAERVAK-LEEMPEQYMTYMQQYGEYEEDDDSMDVKEQSYQEQQQQQQQHFALQ 254
|:|. ||||..|::...| |:::..|......|....:..|.:.:.::|..:.:..:..::|:::
Mouse 13 QELTNHLFPEKSSQIGQKQLQQIERQLKCLAFQNPGPQVADFNPETRQQKKKARMSKMNEYFSVK 77
Fly 255 QQHMQQ 260
.:.|::
Mouse 78 YKVMKK 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167835032 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.