DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13894 and CG13895

DIOPT Version :9

Sequence 1:NP_612054.1 Gene:CG13894 / 38086 FlyBaseID:FBgn0035157 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_001261220.1 Gene:CG13895 / 38087 FlyBaseID:FBgn0035158 Length:506 Species:Drosophila melanogaster


Alignment Length:541 Identity:108/541 - (19%)
Similarity:176/541 - (32%) Gaps:218/541 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MQFFAFPRPENPFHKLWKEACHASL--RRIVPFKKP----------VVCALHFDPSVLGGRR--- 71
            ||...|. |..|:...:|.|.:.:|  |:|...::|          ..|..|...|.....|   
  Fly   134 MQLDGFV-PNKPWINHFKAAYNITLSNRQITIVRRPPRSMDLRDIMSYCGRHTSMSCSLAPRSPE 197

  Fly    72 --LQSNALPTLRLEVPSNLEAVEQQAMVEEI--ERSRKCAYINAVVYEWLVRANINPQLRGSITH 132
              |.|:..|..|.:......: :.||..:|:  .|.||.|::...|||::.|:.:..|  |.:..
  Fly   198 PALTSSDRPLYRTKTLVTTSS-QNQATSDEVHLRRKRKLAFLEKCVYEYIQRSQLVRQ--GRLDL 259

  Fly   133 GMIKDKAENARQVIGSTSFIADNRWLNRFRETHLQGFAQKL-ASNQLKPLGSSLWIPDIV----- 191
            ..::..|.:.|.::...||..|..||..|:..:...|...: .:|:..||  ||.:.|||     
  Fly   260 DNLRFVAISLRDILKIDSFFPDKVWLKHFKSRYNFNFTVGVQVTNRRLPL--SLDLRDIVSYCGR 322

  Fly   192 -------------QDLAHLFPPASAERVAKLEEMPEQYMTYMQQYGEYEEDDDSMDVKEQSYQEQ 243
                         ::|:....| ..::..::|..||::        |:|||||.:.::       
  Fly   323 NEHKITLDHKKSQEELSQSDKP-EVDQCPQVEPKPEEF--------EHEEDDDCVAIE------- 371

  Fly   244 QQQQQQHFALQQQHMQQQQHQMGHPWPPFPGHPGHPTPHPGFASFNDFYFERHQQQMQQQLQQQQ 308
                                                                             
  Fly   372 ----------------------------------------------------------------- 371

  Fly   309 QMQQFPPTMPPQREPFQPQLPPNVPPQRASPFQPVQLAKRPKMESPDDDEVQEINSAVNSPPYPL 373
                                   |||:              .:|..||::               
  Fly   372 -----------------------VPPE--------------LIEIKDDED--------------- 384

  Fly   374 AESTLTSKHSRSSSPNEQNNNNSGGRDSASSKENAPKGGGTSGKSTPALSSKGKDSPAPARAAST 438
                           |:..:|::......::|..:.:.||                |.|......
  Fly   385 ---------------NDDEHNDNEDLPERATKRKSDENGG----------------PIPCGLKIQ 418

  Fly   439 KPASAPASPKKIPNGSSSSGSQTNGHTSPDPEDKKAL--CMLKELESYHQALEYLKPLEDFVLFK 501
            |..|...|   :|..:....:.:.||.| :..|:..|  |    :|||..||..|||||:|||.:
  Fly   419 KIQSLNES---LPEDTELLPANSPGHYS-ETSDEAHLPRC----VESYKDALRLLKPLEEFVLME 475

  Fly   502 ENFRAIGLLSQLELVLRKGDK 522
            ||:||||||:|||.:.....|
  Fly   476 ENYRAIGLLTQLEKIFESAAK 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13894NP_612054.1 THAP 6..82 CDD:214951 18/76 (24%)
CENPB 104..165 CDD:197828 17/60 (28%)
NST1 382..>468 CDD:290656 14/85 (16%)
CG13895NP_001261220.1 HTH 24..74 CDD:304362
CENPB 93..159 CDD:197828 8/25 (32%)
CENPB 232..298 CDD:197828 18/67 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F66R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014353
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.