DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13894 and Thap1

DIOPT Version :9

Sequence 1:NP_612054.1 Gene:CG13894 / 38086 FlyBaseID:FBgn0035157 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_001008341.1 Gene:Thap1 / 306547 RGDID:1307589 Length:210 Species:Rattus norvegicus


Alignment Length:101 Identity:28/101 - (27%)
Similarity:42/101 - (41%) Gaps:15/101 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRRCCIIGCLSNSRQHPSMQFFAFPRPENPFHKLWKEACHASLRR--IVPFKKPVVCALHFDPSV 66
            ::.|...||.:...:...:.|..||.......|.|:    |::||  ..|.|...:|:.||.|..
  Rat     2 VQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKQWE----AAVRRKNFKPTKYSSICSEHFTPDC 62

  Fly    67 L----GGRRLQSNALPTLRL-----EVPSNLEAVEQ 93
            .    ..:.|:.||:||:.|     |....||..||
  Rat    63 FKRECNNKLLKENAVPTIFLYIEPHEKKEELEPQEQ 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13894NP_612054.1 THAP 6..82 CDD:214951 22/81 (27%)
CENPB 104..165 CDD:197828
NST1 382..>468 CDD:290656
Thap1NP_001008341.1 THAP 4..82 CDD:214951 22/81 (27%)
HCFC1-binding motif (HBM). /evidence=ECO:0000250 131..134
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338626
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.