DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13894 and Thap7

DIOPT Version :9

Sequence 1:NP_612054.1 Gene:CG13894 / 38086 FlyBaseID:FBgn0035157 Length:528 Species:Drosophila melanogaster
Sequence 2:XP_008767086.2 Gene:Thap7 / 287944 RGDID:1308061 Length:343 Species:Rattus norvegicus


Alignment Length:351 Identity:59/351 - (16%)
Similarity:107/351 - (30%) Gaps:127/351 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPTIRRCCIIGCLSNSRQHPSMQFFAF-------------------------------------P 28
            ||  |.|...||.:...:....:..:|                                     |
  Rat     1 MP--RHCSAAGCCTRDTRETRNRGISFHRSARVRSGTRGLTCAGAWCCRTLGRAGDSAFLRSKLP 63

  Fly    29 RPENPFHKLWKEACHASLRRIVPFKKPV---------VCALHFDPS------VLGGRRLQSNALP 78
            :.:||...||...|    :|:.|..:.:         .|:.||:.:      :.|..||:..|:|
  Rat    64 KKDNPRRGLWLANC----QRLDPSGQGLWDPTSEYIYFCSKHFEENCFELVGISGYHRLKEGAVP 124

  Fly    79 TLRLEVPSNLEAVEQQAM------VEEIERSRKCAYINAVVYEWLVRAN--------INPQLRGS 129
            |: .|..|.|....:..:      :.::.|.|:|.          .|.:        .:|..|..
  Rat   125 TI-FESFSKLRRTAKTKVHGYPPGLPDVSRLRRCR----------KRCSERQGPTIPFSPPPRAD 178

  Fly   130 ITHGMIKDKAENARQVIGSTSFIADNRWLNRFRETHLQGFAQKLASNQLKPLGSSLWIPDIVQDL 194
            |....:::.:..|.              |.......|........|:.|.|||:.      ..:.
  Rat   179 IIRFPVEEASAPAT--------------LPASPAARLDPGLNSPFSDLLGPLGAQ------ADEA 223

  Fly   195 AHLFPPASAERVAKLEEM---PEQYM--------TYMQQYGEYEEDD------------DSMDVK 236
            .....|:..:..:.||..   |..||        .|:|....|:...            |::| |
  Rat   224 GCSAQPSPEQHPSPLEPQHVSPSTYMLRLPPPAGAYIQNEHSYQVGSALLWKRRAEAALDALD-K 287

  Fly   237 EQSYQEQQQQQQQHFALQQQHMQQQQ 262
            .|...:..::::|...|:...:||::
  Rat   288 TQRQLQACKRREQRLRLRLTKLQQER 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13894NP_612054.1 THAP 6..82 CDD:214951 21/127 (17%)
CENPB 104..165 CDD:197828 8/68 (12%)
NST1 382..>468 CDD:290656
Thap7XP_008767086.2 THAP 4..127 CDD:214951 21/127 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338629
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.