Sequence 1: | NP_612054.1 | Gene: | CG13894 / 38086 | FlyBaseID: | FBgn0035157 | Length: | 528 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_653322.1 | Gene: | THAP6 / 152815 | HGNCID: | 23189 | Length: | 222 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 45/204 - (22%) |
---|---|---|---|
Similarity: | 78/204 - (38%) | Gaps: | 62/204 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 IRRCCIIG----CLSNSRQHPSMQFFAFPRPENPFHKLWKEACHASLRRI--------VPFKKPV 56
Fly 57 VCALHFD------------------PSV------LGGRRLQSNALPTLRLE-VPS---NLEAVEQ 93
Fly 94 QAMVEEIERSRKCAYINAVVYEWLVRANINP-QLRGSITH--GMIKDKAENARQVIGSTSFIADN 155
Fly 156 RWLNRFRET 164 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13894 | NP_612054.1 | THAP | 6..82 | CDD:214951 | 26/111 (23%) |
CENPB | 104..165 | CDD:197828 | 12/64 (19%) | ||
NST1 | 382..>468 | CDD:290656 | |||
THAP6 | NP_653322.1 | THAP | 4..90 | CDD:214951 | 23/91 (25%) |
HCFC1-binding motif (HBM). /evidence=ECO:0000250 | 139..142 | 1/2 (50%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165144928 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |