DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13894 and THAP6

DIOPT Version :9

Sequence 1:NP_612054.1 Gene:CG13894 / 38086 FlyBaseID:FBgn0035157 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_653322.1 Gene:THAP6 / 152815 HGNCID:23189 Length:222 Species:Homo sapiens


Alignment Length:204 Identity:45/204 - (22%)
Similarity:78/204 - (38%) Gaps:62/204 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IRRCCIIG----CLSNSRQHPSMQFFAFPRPENPFHKLWKEACHASLRRI--------VPFKKPV 56
            ::.|..||    ||.||:. ..:.|..||..|| ..:.|..|    ::|:        .|.|..|
Human     2 VKCCSAIGCASRCLPNSKL-KGLTFHVFPTDEN-IKRKWVLA----MKRLDVNAAGIWEPKKGDV 60

  Fly    57 VCALHFD------------------PSV------LGGRRLQSNALPTLRLE-VPS---NLEAVEQ 93
            :|:.||.                  ||:      |.|:|.:.:......|: ||:   |...|..
Human    61 LCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFTLKTVPATNYNHHLVGA 125

  Fly    94 QAMVEEIERSRKCAYINAVVYEWLVRANINP-QLRGSITH--GMIKDKAENARQVIGSTSFIADN 155
            .:.:||.:        :..::|.......:| :|:..:.|  |.::|..|:.|.|:.     .:.
Human   126 SSCIEEFQ--------SQFIFEHSYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLD-----REK 177

  Fly   156 RWLNRFRET 164
            |:....|:|
Human   178 RFQKSLRKT 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13894NP_612054.1 THAP 6..82 CDD:214951 26/111 (23%)
CENPB 104..165 CDD:197828 12/64 (19%)
NST1 382..>468 CDD:290656
THAP6NP_653322.1 THAP 4..90 CDD:214951 23/91 (25%)
HCFC1-binding motif (HBM). /evidence=ECO:0000250 139..142 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144928
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.