DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13894 and LOC100332023

DIOPT Version :9

Sequence 1:NP_612054.1 Gene:CG13894 / 38086 FlyBaseID:FBgn0035157 Length:528 Species:Drosophila melanogaster
Sequence 2:XP_002665776.1 Gene:LOC100332023 / 100332023 -ID:- Length:491 Species:Danio rerio


Alignment Length:258 Identity:54/258 - (20%)
Similarity:96/258 - (37%) Gaps:67/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CCIIGCLSNSRQHPSMQFFAFPRPENPFHKLWKEACHASLRR--IVPFKKPVVCALHFDPSVL-- 67
            ||:..|.::::.:..:.|..||: :....:.|.    .::||  ....:|..||:.||:.|.|  
Zfish    22 CCVPQCTASAKFNSYLSFHTFPK-DTDLQERWV----VNIRRDNFTVTQKTRVCSRHFESSDLIE 81

  Fly    68 -----GGRRLQSNALPTL-----------------RLEVPSNLEAVEQQAMVEEIERSRKCAYIN 110
                 |.|.|:..|:|.|                 |::.| |.:.......|:        ..:|
Zfish    82 PRAPTGRRHLKKGAVPVLFQW
NNFAVSAARPGVWERIKRP-NTDLTLDDPSVD--------VSVN 137

  Fly   111 AVVYEWLVRANINPQLRGSITHGMIKDKAENARQVIGSTS---------FIA---DNRWLNRF-R 162
            ...::::..|. :..|..|:.|..::.:..|.|:.|...|         |.|   |.|:..|| .
Zfish   138 YSDHDYVSTAE-SDALDLSLDHTDLRVEIANLRKQIEEISLSNKFCLERFAASDDDIRFYTRFAS 201

  Fly   163 ETHLQGFAQKLASNQLKPLGSSLWIPDIVQDLAHLFPPASAERVAKLEEMPE-----QYMTYM 220
            ..||..|.:     |::|....:......|..|:   |......|:...:|.     .:|||:
Zfish   202 HGHLMAFWR-----QIEPATGKIVRVSRTQTAAN---PDEVPHTARATSLPPIDEFFLFMTYL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13894NP_612054.1 THAP 6..82 CDD:214951 22/100 (22%)
CENPB 104..165 CDD:197828 15/73 (21%)
NST1 382..>468 CDD:290656
LOC100332023XP_002665776.1 THAP 21..102 CDD:283206 22/84 (26%)
HTH_Tnp_4 241..293 CDD:290344 4/16 (25%)
DDE_Tnp_4 321..477 CDD:290096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.