DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vti1a and VTI1B

DIOPT Version :9

Sequence 1:NP_612053.1 Gene:Vti1a / 38085 FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_564255.1 Gene:VTI1B / 839208 AraportID:AT1G26670 Length:222 Species:Arabidopsis thaliana


Alignment Length:212 Identity:60/212 - (28%)
Similarity:110/212 - (51%) Gaps:5/212 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLEQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLR 67
            :.|.||:||..|...::.........:|..|:....::|.|.:.||..|:.:|.||.|.|.|..:
plant     4 VFEGYERQYCELSTNLSRKCHSASVLSNGEEKKGKIAEIKSGIDEADVLIRKMDLEARSLQPSAK 68

  Fly    68 SSFNGKLQVAQAELKRLQAEYR--LTKDKQRSQANTFTTLDLGDSYEDVSISTDQRQRLLDNSER 130
            :....||:..:::|.:|:.|::  .:.|.:.|.........:.|.:   ::|.|||.||..:.||
plant    69 AVCLSKLREYKSDLNQLKKEFKRVSSADAKPSSREELMESGMADLH---AVSADQRGRLAMSVER 130

  Fly   131 IERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNTMMLRAL 195
            ::::.:|:.|..|:.||||::|..::.||..||:||..|..:|...:..:.::.:.|..|..|..
plant   131 LDQSSDRIRESRRLMLETEEVGISIVQDLSQQRQTLLHAHNKLHGVDDAIDKSKKVLTAMSRRMT 195

  Fly   196 REKVVLYGVGVCFVVAV 212
            |.|.::..|.|..|:|:
plant   196 RNKWIITSVIVALVLAI 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 20/77 (26%)
SNARE_Vti1a 128..189 CDD:277244 19/60 (32%)
VTI1BNP_564255.1 V-SNARE 12..90 CDD:398604 20/77 (26%)
SNARE_Vti1 128..188 CDD:277215 18/59 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4359
eggNOG 1 0.900 - - E1_KOG1666
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I2155
OMA 1 1.010 - - QHG54893
OrthoDB 1 1.010 - - D1195966at2759
OrthoFinder 1 1.000 - - FOG0003233
OrthoInspector 1 1.000 - - otm2538
orthoMCL 1 0.900 - - OOG6_101479
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.