DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vti1a and VTI13

DIOPT Version :9

Sequence 1:NP_612053.1 Gene:Vti1a / 38085 FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001327544.1 Gene:VTI13 / 822557 AraportID:AT3G29100 Length:221 Species:Arabidopsis thaliana


Alignment Length:221 Identity:69/221 - (31%)
Similarity:117/221 - (52%) Gaps:18/221 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EQYEQQYATLIAEIT-------AHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVREL 62
            |:||:||..:.|.::       |..|..::||        .|:|.|.:.||:.|:::|.||.|.|
plant     6 ERYERQYCEISANLSKKCTSAIALDGEQKKQN--------LSEIKSGVEEAEALVKKMDLEARNL 62

  Fly    63 NPGLRSSFNGKLQVAQAELKRLQAEY-RLTKDKQRSQANTFTTLDLGDSYEDVSISTDQRQRLLD 126
            .|.::||...||:..:::|...:.|. |:|.....:.|.. ..|:.|.: :.::.|.|||.||:.
plant    63 PPNVKSSLLVKLREYKSDLNNFKTEVKRITSGNLNATARD-ELLEAGMA-DTLTASADQRSRLMM 125

  Fly   127 NSERIERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNTMM 191
            :::.:.||.:|:.:..|..||||:||..:|.|||.||::|..|...|...:..:|::.:.|.||.
plant   126 STDHLGRTTDRIKDSRRTILETEELGVSILQDLHGQRQSLLRAHETLHGVDDNVGKSKKILTTMT 190

  Fly   192 LRALREKVVLYGVGVCFVVAVGVSLY 217
            .|..|.|..:..:....|:|:...||
plant   191 RRMNRNKWTIGAIITVLVLAIIFILY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 24/85 (28%)
SNARE_Vti1a 128..189 CDD:277244 21/60 (35%)
VTI13NP_001327544.1 V-SNARE 12..90 CDD:368237 24/85 (28%)
SNARE_Vti1 127..188 CDD:277215 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4359
eggNOG 1 0.900 - - E1_KOG1666
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39963
Inparanoid 1 1.050 102 1.000 Inparanoid score I2155
OMA 1 1.010 - - QHG54893
OrthoDB 1 1.010 - - D1195966at2759
OrthoFinder 1 1.000 - - FOG0003233
OrthoInspector 1 1.000 - - otm2538
orthoMCL 1 0.900 - - OOG6_101479
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.