DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vti1a and vti1a

DIOPT Version :9

Sequence 1:NP_612053.1 Gene:Vti1a / 38085 FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_005156392.1 Gene:vti1a / 567385 ZFINID:ZDB-GENE-050809-135 Length:224 Species:Danio rerio


Alignment Length:214 Identity:79/214 - (36%)
Similarity:134/214 - (62%) Gaps:2/214 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLRSS 69
            |.|||.:.||.||||..|||:.:. ...|:..|...:|..|.|.:||:|||.|||||:....|:.
Zfish     6 EAYEQDFGTLTAEITNKIGRIPKL-AGEEKTQLVLNVDKQLEEVRELMEQMDLEVREIPIQSRAM 69

  Fly    70 FNGKLQVAQAELKRLQAEYRLTKDKQRSQANTFTTLDLGDSYEDVSIS-TDQRQRLLDNSERIER 133
            :|.:|:..:.|:::|:.:::.::.....:.......|.|.|.|...|. .::|..||||:||:||
Zfish    70 YNSRLKSYKQEMEKLEKDFKRSRIAYSDEVRNELLGDDGSSSETQLIKLREERAHLLDNTERLER 134

  Fly   134 TGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNTMMLRALREK 198
            :..||..||::|:||||:|.::|.:||..||.:|.:|.|||||:|.||::||.|..|:.|.::.:
Zfish   135 SSRRLEAGYQIAVETEQVGQEILANLHSDREKIQRSRDRLRETDANLGKSSRILTGMLRRIIQNR 199

  Fly   199 VVLYGVGVCFVVAVGVSLY 217
            ::::.:|...::.:.:::|
Zfish   200 ILVFILGAIILLTIVLAIY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 29/77 (38%)
SNARE_Vti1a 128..189 CDD:277244 32/60 (53%)
vti1aXP_005156392.1 V-SNARE 12..90 CDD:282816 29/78 (37%)
SNARE_Vti1a 129..190 CDD:277244 32/60 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576430
Domainoid 1 1.000 73 1.000 Domainoid score I9253
eggNOG 1 0.900 - - E1_KOG1666
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39963
Inparanoid 1 1.050 148 1.000 Inparanoid score I4366
OMA 1 1.010 - - QHG54893
OrthoDB 1 1.010 - - D1195966at2759
OrthoFinder 1 1.000 - - FOG0003233
OrthoInspector 1 1.000 - - oto39118
orthoMCL 1 0.900 - - OOG6_101479
Panther 1 1.100 - - LDO PTHR21230
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1665
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.