DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vti1a and Vti1a

DIOPT Version :9

Sequence 1:NP_612053.1 Gene:Vti1a / 38085 FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_006527247.1 Gene:Vti1a / 53611 MGIID:1855699 Length:292 Species:Mus musculus


Alignment Length:190 Identity:74/190 - (38%)
Similarity:121/190 - (63%) Gaps:2/190 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLRSS 69
            |.|||.:|.|.||||:.|.|:.:...: |:..:.:.::..|.||:||||||.|||||:.|..|..
Mouse     6 EGYEQDFAVLTAEITSKIARVPRLPPD-EKKQMVANVEKQLEEARELLEQMDLEVREIPPQSRGM 69

  Fly    70 FNGKLQVAQAELKRLQAEYRLTKDKQRSQANTFTTLDLGDSYEDVSIS-TDQRQRLLDNSERIER 133
            ::.:::..:.|:.:|:.:::.::.....:.......|.|:|.|:..|. .::|..||||:||:||
Mouse    70 YSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDAGNSSENQLIKLREERAHLLDNTERLER 134

  Fly   134 TGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNTMMLR 193
            :..||..||::|:||||:|.::|.:|.|.||.:|.||.|||:.:|.||::||.|..|:.|
Mouse   135 SSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARDRLRDADANLGKSSRILTGMLRR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 27/77 (35%)
SNARE_Vti1a 128..189 CDD:277244 31/60 (52%)
Vti1aXP_006527247.1 V-SNARE 12..90 CDD:368237 27/77 (35%)
SNARE_Vti1a 129..190 CDD:277244 31/60 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833712
Domainoid 1 1.000 71 1.000 Domainoid score I9446
eggNOG 1 0.900 - - E1_KOG1666
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39963
Inparanoid 1 1.050 148 1.000 Inparanoid score I4385
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54893
OrthoDB 1 1.010 - - D1195966at2759
OrthoFinder 1 1.000 - - FOG0003233
OrthoInspector 1 1.000 - - oto92118
orthoMCL 1 0.900 - - OOG6_101479
Panther 1 1.100 - - LDO PTHR21230
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1665
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.