DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vti1a and Vti1b

DIOPT Version :9

Sequence 1:NP_612053.1 Gene:Vti1a / 38085 FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001138075.1 Gene:Vti1b / 42215 FlyBaseID:FBgn0264751 Length:122 Species:Drosophila melanogaster


Alignment Length:118 Identity:31/118 - (26%)
Similarity:59/118 - (50%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 YEDVSISTDQRQR----LLDNSERIERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARA 171
            |..:...:||.:|    .....:.::||.:.:....::|:|||.:||:||.:|..|||:|.....
  Fly     6 YSQLPSGSDQERRQAQLAASTYDVLQRTTDSIQRSNQIAIETENMGAEVLGELGEQRESLLRTTR 70

  Fly   172 RLRETNAELGRASRTLNTMMLRALREKVVLYGVGVCFVVAVGV---SLYLTFA 221
            ||.:.:.:|.::...:..:....|..|::|.   :..::.||:   .|.|.||
  Fly    71 RLEDADQDLSKSRVIIRKLSREVLYNKIILI---LIIILEVGILVGLLVLKFA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816
SNARE_Vti1a 128..189 CDD:277244 18/60 (30%)
Vti1bNP_001138075.1 SNARE_Vti1b 27..88 CDD:277243 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443431
Domainoid 1 1.000 50 1.000 Domainoid score I4359
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.