DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vti1a and vti-1

DIOPT Version :9

Sequence 1:NP_612053.1 Gene:Vti1a / 38085 FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_502781.1 Gene:vti-1 / 178397 WormBaseID:WBGene00013302 Length:224 Species:Caenorhabditis elegans


Alignment Length:219 Identity:76/219 - (34%)
Similarity:138/219 - (63%) Gaps:10/219 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LEQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVREL--NPGL 66
            |..:|:||:...||||:.|||:... .:|:|.....:|..||.|..:||:||.|.||||  |...
 Worm    11 LSGFEKQYSLQTAEITSKIGRVHTL-PSSDRAGAVQEIRKSLEEVNDLLDQMELVVRELESNTTE 74

  Fly    67 RSSFNGKLQVAQAELKRLQAEYRLTKDKQRSQANTFTTLDLGDSYEDVSISTDQRQRLLDNSERI 131
            |:.:..:::..|::.|:|..|......:.|.:|:....|...|..::    ..|..:|:.|::|:
 Worm    75 RTKYELRVRSYQSDKKQLDTELEKAIKRVREEADRDELLAFDDQLDE----HRQEDQLIANTQRL 135

  Fly   132 ERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNTMMLRALR 196
            ||:..::.:.:|:|:||||:||::|::|..||||:..:|.|||::||:||||::||::|:.||::
 Worm   136 ERSTRKVQDAHRIAVETEQIGAEMLSNLASQRETIGRSRDRLRQSNADLGRANKTLSSMIRRAIQ 200

  Fly   197 EKVVLYGVGVCFVVAVGVSLYLTF 220
            .:::|  :.|.|:::. :.||:.:
 Worm   201 NRLLL--LIVTFLLSF-MFLYIVY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 29/79 (37%)
SNARE_Vti1a 128..189 CDD:277244 29/60 (48%)
vti-1NP_502781.1 V-SNARE 18..98 CDD:368237 29/80 (36%)
SNARE_Vti1a 132..193 CDD:277244 29/60 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157647
Domainoid 1 1.000 71 1.000 Domainoid score I6184
eggNOG 1 0.900 - - E1_KOG1666
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39963
Inparanoid 1 1.050 123 1.000 Inparanoid score I3306
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54893
OrthoDB 1 1.010 - - D1195966at2759
OrthoFinder 1 1.000 - - FOG0003233
OrthoInspector 1 1.000 - - oto18175
orthoMCL 1 0.900 - - OOG6_101479
Panther 1 1.100 - - LDO PTHR21230
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1665
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.