DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vti1a and VTI1B

DIOPT Version :9

Sequence 1:NP_612053.1 Gene:Vti1a / 38085 FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_006361.1 Gene:VTI1B / 10490 HGNCID:17793 Length:232 Species:Homo sapiens


Alignment Length:205 Identity:52/205 - (25%)
Similarity:91/205 - (44%) Gaps:15/205 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLRSSFNGKLQVAQAELKRLQAEY 88
            ||.......|:..|....|....||.|.|.:|..|:|......|:....||:..:.:|.:|..|.
Human    31 RLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREV 95

  Fly    89 RLTKDKQRSQANTFTTLDLGD--------SYEDVSISTDQRQRLLDNSERIERTGNRLTEGYRVA 145
                   ||...|.|....||        ..|.::....||..||..:|.:.|....:...:|:|
Human    96 -------R
STPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIA 153

  Fly   146 LETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNTMMLRALREKVVLYGVGVCFVV 210
            .||:|:|::::.:|..||:.|:..::||..|:..|.::.:.|.:|..:....|::|..:.:..:.
Human   154 TETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLELA 218

  Fly   211 AVGVSLYLTF 220
            .:|..:|..|
Human   219 ILGGLVYYKF 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 18/64 (28%)
SNARE_Vti1a 128..189 CDD:277244 17/60 (28%)
VTI1BNP_006361.1 Interaction with CLINT1. /evidence=ECO:0000269|PubMed:18033301, ECO:0007744|PDB:2V8S 2..23
V-SNARE 18..96 CDD:309928 18/71 (25%)
Interaction with CLINT1. /evidence=ECO:0000269|PubMed:18033301, ECO:0007744|PDB:2V8S 69..73 0/3 (0%)
SNARE_Vti1b 136..197 CDD:277243 17/60 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1666
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54893
OrthoDB 1 1.010 - - D1195966at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.