Sequence 1: | NP_612053.1 | Gene: | Vti1a / 38085 | FlyBaseID: | FBgn0260862 | Length: | 230 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006361.1 | Gene: | VTI1B / 10490 | HGNCID: | 17793 | Length: | 232 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 52/205 - (25%) |
---|---|---|---|
Similarity: | 91/205 - (44%) | Gaps: | 15/205 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 RLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLRSSFNGKLQVAQAELKRLQAEY 88
Fly 89 RLTKDKQRSQANTFTTLDLGD--------SYEDVSISTDQRQRLLDNSERIERTGNRLTEGYRVA 145
Fly 146 LETEQLGAQVLNDLHHQRETLQGARARLRETNAELGRASRTLNTMMLRALREKVVLYGVGVCFVV 210
Fly 211 AVGVSLYLTF 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Vti1a | NP_612053.1 | V-SNARE | 11..89 | CDD:282816 | 18/64 (28%) |
SNARE_Vti1a | 128..189 | CDD:277244 | 17/60 (28%) | ||
VTI1B | NP_006361.1 | Interaction with CLINT1. /evidence=ECO:0000269|PubMed:18033301, ECO:0007744|PDB:2V8S | 2..23 | ||
V-SNARE | 18..96 | CDD:309928 | 18/71 (25%) | ||
Interaction with CLINT1. /evidence=ECO:0000269|PubMed:18033301, ECO:0007744|PDB:2V8S | 69..73 | 0/3 (0%) | |||
SNARE_Vti1b | 136..197 | CDD:277243 | 17/60 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1666 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG54893 | |
OrthoDB | 1 | 1.010 | - | - | D1195966at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.830 |