DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and YPT31

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_010948.1 Gene:YPT31 / 856753 SGDID:S000000833 Length:223 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:67/202 - (33%)
Similarity:111/202 - (54%) Gaps:18/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |::|.||.|||||:|..||..|.|  :.|.|||:|::...|...::.|:||.|:|||.|.||..:
Yeast    15 KIVLIGDSGVGKSNLLSRFTKNEF--NMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRA 77

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138
            :||:||:.|.||::|:.:..::|:.:.:..|.::...| :|..:.:.|||||| .....|..||.
Yeast    78 ITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDL-AHLRAVPTEES 141

  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGAAT 203
            :.|.::...|.:   :||..:...|::.|    .:|::....|:.    :|   |:|...|.|..
Yeast   142 KTFAQENQLLFT---ETSALNSENVDKAF----EELINTIYQKVS----KH---QMDLGDSSANG 192

  Fly   204 NEEDASS 210
            |...||:
Yeast   193 NANGASA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 58/166 (35%)
Rab 10..172 CDD:206640 57/162 (35%)
YPT31NP_010948.1 Rab11_like 11..175 CDD:206660 58/169 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.