DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and YPT7

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_013713.1 Gene:YPT7 / 855012 SGDID:S000004460 Length:208 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:57/210 - (27%)
Similarity:107/210 - (50%) Gaps:17/210 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVN-EKQIKLQLWDTGGMERVA 73
            |||:.||.||||:||..|:..:.:  ....|:|:|.|.:.:|.:|: :|...:|:|||.|.||..
Yeast    10 KVIILGDSGVGKTSLMHRYVNDKY--SQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQERFQ 72

  Fly    74 SVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-----ENAKIFICGNKSDLDGREPEV 133
            |:..::|:.|:..:||:.:.||:||.::.....:.:.:|     |.....|.|||.|.:..:..|
Yeast    73 SLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIV 137

  Fly   134 SDEEVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTAS 198
            |::..:...:....:  ..:.||.::...|:..|.:|:|..:..|::..|       :|:.|...
Yeast   138 SEKSAQELAKSLGDI--PLFLTSAKNAINVDTAFEEIARSALQQNQADTE-------AFEDDYND 193

  Fly   199 SGAATNEEDASSCGC 213
            :.....:.:.:||.|
Yeast   194 AINIRLDGENNSCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 50/171 (29%)
Rab 10..172 CDD:206640 49/167 (29%)
YPT7NP_013713.1 Rab7 9..182 CDD:206655 51/175 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.