DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and RABA1b

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_173136.1 Gene:RABA1b / 838263 AraportID:AT1G16920 Length:216 Species:Arabidopsis thaliana


Alignment Length:215 Identity:70/215 - (32%)
Similarity:110/215 - (51%) Gaps:27/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            ||:|.||.|||||:|..||..|.|  :.:.|||:|::...|...|:.|.:|.|:|||.|.||..:
plant    15 KVVLIGDSGVGKSNLLSRFTKNEF--NLESKSTIGVEFATRTLKVDGKVVKAQIWDTAGQERYRA 77

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDL---------DGR 129
            :||:||:.|.||:||:.:...|:|.::.:.|.::..:.: |..:.:.||||||         ||:
plant    78 ITSAYYRGAVGALLVYDVTRRATFENVDRWLKELKNHTDPNIVVMLVGNKSDLRHLLAVPTEDGK 142

  Fly   130 EPEVSDEEVEAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQV 194
                |..|.|:.|         ..:||......||:.|.::..| ::...||.:::|.|..:..|
plant   143 ----SYAEQESLC---------FMETSALEATNVEDAFAEVLTQ-IYRITSKKQVEAGEDGNASV 193

  Fly   195 DTASSGAATNEEDA-SSCGC 213
            .........|:..| ...||
plant   194 PKGEKIEVKNDVSALKKLGC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 61/175 (35%)
Rab 10..172 CDD:206640 60/171 (35%)
RABA1bNP_173136.1 Rab11_like 11..175 CDD:206660 61/175 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.