DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and RAB1A

DIOPT Version :10

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_568678.1 Gene:RAB1A / 834766 AraportID:AT5G47200 Length:202 Species:Arabidopsis thaliana


Alignment Length:159 Identity:63/159 - (39%)
Similarity:94/159 - (59%) Gaps:7/159 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |::|.||.|||||.|..|||.::::  ....||:|:|...|....:.|.||||:|||.|.||..:
plant    10 KLLLIGDSGVGKSCLLLRFADDSYL--DSYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRT 72

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138
            :|||||:.|.|.|:.:.:.:..||:::.|.|.:|..|| ||....:.|||:||..:: .||.|..
plant    73 ITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYASENVNKLLVGNKNDLTSQK-VVSTETA 136

  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMF 167
            :||.::   |.....:||.::...|||.|
plant   137 KAFADE---LGIPFLETSAKNATNVEEAF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 Rab 10..172 CDD:206640 63/159 (40%)
RAB1ANP_568678.1 Rab1_Ypt1 7..172 CDD:206661 63/159 (40%)

Return to query results.
Submit another query.