DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and RABA1c

DIOPT Version :10

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_199387.1 Gene:RABA1c / 834614 AraportID:AT5G45750 Length:216 Species:Arabidopsis thaliana


Alignment Length:194 Identity:67/194 - (34%)
Similarity:105/194 - (54%) Gaps:15/194 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            ||:|.||.|||||:|..||..|.|  ..:.|||:|::...|..:|::|.||.|:|||.|.||..:
plant    15 KVVLIGDSGVGKSNLLSRFTKNEF--SLESKSTIGVEFATRSLNVDDKVIKAQIWDTAGQERYRA 77

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138
            :||:||:.|.||:||:.:...::|.::...|.::..:.: |..:.:.|||||| .....|..|:.
plant    78 ITSAYYRGAVGALLVYDVTRHSTFENVETWLKELRNHTDPNIVVMLVGNKSDL-RHLVAVQTEDA 141

  Fly   139 EAFCEQCHSLISATY--KTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSG 200
            ::|.|:     .:.|  :||......||..|.::..|:.|....|    |:|..|...:..|.|
plant   142 KSFAEK-----ESLYFMETSALEATNVENAFAEVLTQIHHIVSKK----AMEAASESANVPSKG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 Rab 10..172 CDD:206640 59/164 (36%)
RABA1cNP_199387.1 Rab11_like 11..175 CDD:206660 60/167 (36%)

Return to query results.
Submit another query.