DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and RABG1

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_568566.1 Gene:RABG1 / 833958 AraportID:AT5G39620 Length:204 Species:Arabidopsis thaliana


Alignment Length:220 Identity:64/220 - (29%)
Similarity:113/220 - (51%) Gaps:26/220 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MRIPKQKVILCGDYGVGKSSLFRRFATNTFITDTDRK----STLGLDHIDREYSVNEKQIKLQLW 64
            |...|.|:||.||.||||:||.:|:      .|.|.|    ||:.:|.:.:|..:.|:|:.||:|
plant     1 MEKTKLKIILLGDSGVGKTSLLKRY------NDKDFKQLHNSTIYVDLVTKEICIAERQVILQIW 59

  Fly    65 DTGGMERVASVTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA--ENAKIF---ICGNKS 124
            ||.|.||..|:.|.:|:..:..:||:.::...:|.|:.....:.:..|  |....|   :.|||:
plant    60 DTAGQERFKSLPSRFYRDTDCCVLVYDVNTLKTFESIDNWHDEFIKQANPETPTKFPFVLMGNKT 124

  Fly   125 DLDGREPEVSDEEV-EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALE 188
            |::..:|.|..:|: :.:|....:::  .::||.::...|||.|.:|:::   |..::.::..:|
plant   125 DVNNGKPRVVAKEIADQWCGSKGNIV--YFETSAKAKINVEEAFLEIAKK---ALTNERQIDDME 184

  Fly   189 HKSFQVDTASSGAATNEEDASSCGC 213
            .....|.|..     .|...|.|.|
plant   185 RYRSVVPTIE-----KETPRSRCSC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 54/175 (31%)
Rab 10..172 CDD:206640 54/171 (32%)
RABG1NP_568566.1 P-loop_NTPase 6..179 CDD:393306 55/183 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.