DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and RABA4B

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_195709.1 Gene:RABA4B / 830160 AraportID:AT4G39990 Length:224 Species:Arabidopsis thaliana


Alignment Length:196 Identity:67/196 - (34%)
Similarity:102/196 - (52%) Gaps:20/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            ||:|.||..||||.|..|||.:.|  ..|.|:|:|::...|..|:.:|.||.|:|||.|.||..:
plant    19 KVVLIGDSAVGKSQLLARFARDEF--SMDSKATIGVEFQTRTLSIEQKSIKAQIWDTAGQERYRA 81

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138
            |||:||:.|.||:||:.:....:|..:.:.|.::..:|: |..|.:.||||||:.:. .|..|:.
plant    82 VTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDLEDQR-AVPTEDA 145

  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGAAT 203
            :.|.|: ..|.  ..:||..:...||..|..:..|:.:....|             :.||.|.:.
plant   146 KEFAEK-EGLF--FLETSALNATNVENSFNTLMTQIYNTVNKK-------------NLASEGDSN 194

  Fly   204 N 204
            |
plant   195 N 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 62/166 (37%)
Rab 10..172 CDD:206640 61/162 (38%)
RABA4BNP_195709.1 PLN03110 15..223 CDD:178657 67/196 (34%)
Rab11_like 15..179 CDD:206660 62/165 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.