DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and RABB1C

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_193450.1 Gene:RABB1C / 827428 AraportID:AT4G17170 Length:211 Species:Arabidopsis thaliana


Alignment Length:159 Identity:63/159 - (39%)
Similarity:87/159 - (54%) Gaps:7/159 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |.|:.||.|||||.|..:|....|....|  .|:|::...|..:::.|.||||:|||.|.|...|
plant     8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHD--LTIGVEFGARMITIDNKPIKLQIWDTAGQESFRS 70

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138
            :|.|||:.|.||:||:.:....:|:.|:..|.|...:|. |..|.:.|||.||..|. .||.||.
plant    71 ITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCDLAHRR-AVSTEEG 134

  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMF 167
            |.|.:: |.||  ..:.|.::...|||.|
plant   135 EQFAKE-HGLI--FMEASAKTAQNVEEAF 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 63/159 (40%)
Rab 10..172 CDD:206640 63/159 (40%)
RABB1CNP_193450.1 PLN03108 1..210 CDD:178655 63/159 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.