DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and ArRABA1h

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_180943.4 Gene:ArRABA1h / 817957 AraportID:AT2G33870 Length:218 Species:Arabidopsis thaliana


Alignment Length:208 Identity:68/208 - (32%)
Similarity:112/208 - (53%) Gaps:11/208 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            ||:|.||.|||||:|..||..|.|  ..|.:||:|::...|...|::|.:|.|:|||.|.||..:
plant    15 KVVLTGDSGVGKSNLLSRFTRNDF--SHDSRSTIGVEFATRSIQVDDKIVKAQIWDTAGQERYRA 77

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138
            :||:||:.|.||:||:.:....:|.::.:.|.::..:.: |..|.:.|||:||:... .:|.|||
plant    78 ITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANTVIMLVGNKADLNHLR-AISTEEV 141

  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGAAT 203
            :.|.|:.::..   .:||......||..|.::..| ::...||..|.|.:..:..:.........
plant   142 KDFAERENTFF---METSALEAINVENAFTEVLTQ-IYRVVSKKALDAGDDPTTALPKGQMINVG 202

  Fly   204 NEEDASS---CGC 213
            :.:|.|:   .||
plant   203 SRDDVSAVKKSGC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 60/166 (36%)
Rab 10..172 CDD:206640 59/162 (36%)
ArRABA1hNP_180943.4 Rab11_like 11..175 CDD:206660 60/166 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.