DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and rab26

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_012826040.1 Gene:rab26 / 780350 XenbaseID:XB-GENE-489728 Length:249 Species:Xenopus tropicalis


Alignment Length:202 Identity:66/202 - (32%)
Similarity:104/202 - (51%) Gaps:25/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            ||:|.||.||||:.|..||....|:..: ..||:|:|..::..:|:..::|||:|||.|.||..|
 Frog    58 KVMLVGDSGVGKTCLLVRFKDGAFLAGS-FISTVGIDFRNKVLNVDGVKVKLQIWDTAGQERFRS 121

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138
            ||.:||:.|...:|::.:.|.:||.::...|.:|..||: :..|.:.|||.| ...|..|..|:.
 Frog   122 VTHAYYRDAHALLLLYDVTNKSSFDNIQAWLTEIHEYAQKDVVIMLLGNKVD-STHERVVKIEDG 185

  Fly   139 EAFCEQCHSLISATY-----KTSCRSGAGVEEMFRDISRQLVH-----ANRSKMELQALEHKSFQ 193
            |...::        |     :||.:||..|:..|..|:::|.|     .|..|.:|    |...:
 Frog   186 ERLAKE--------YGVPFMETSAKSGLNVDLAFIAIAKELKHRSMKLPNEPKFKL----HDYVK 238

  Fly   194 VDTASSG 200
            .:...||
 Frog   239 KEVKGSG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 59/171 (35%)
Rab 10..172 CDD:206640 58/167 (35%)
rab26XP_012826040.1 Rab26 57..247 CDD:206695 66/202 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.