DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Rab2b

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_766189.1 Gene:Rab2b / 76338 MGIID:1923588 Length:216 Species:Mus musculus


Alignment Length:216 Identity:78/216 - (36%)
Similarity:115/216 - (53%) Gaps:26/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |.|:.||.|||||.|..:|....|....|  .|:|::...|..:::.||||||:|||.|.|...|
Mouse     8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHD--LTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRS 70

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTY-AENAKIFICGNKSDLDGREPEVSDEEV 138
            :|.|||:.|.||:||:.:....:|:.|:..|.|...: :.|..|.:.||||||:.|. :|..||.
Mouse    71 ITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESRR-DVKREEG 134

  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMF----RDISRQL------VH--ANRSKMELQALEHKS 191
            |||..: |.||  ..:||.::...|||.:    ::|.|::      ||  ||..|:..|      
Mouse   135 EAFARE-HGLI--FMETSAKTACNVEEAYINTAKEIYRKIQQGLFDVHNEANGIKIGPQ------ 190

  Fly   192 FQVDTASSGAATNEEDASSCG 212
             |..|:|.|..:.:::.|..|
Mouse   191 -QSITSSVGPCSPQQNVSDIG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 66/176 (38%)
Rab 10..172 CDD:206640 65/166 (39%)
Rab2bNP_766189.1 PLN03108 1..216 CDD:178655 78/216 (36%)
Rab2 3..170 CDD:206658 65/167 (39%)
Effector region. /evidence=ECO:0000250 35..43 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..216 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.