DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and rab43

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001038812.1 Gene:rab43 / 751627 ZFINID:ZDB-GENE-060825-25 Length:208 Species:Danio rerio


Alignment Length:211 Identity:67/211 - (31%)
Similarity:110/211 - (52%) Gaps:24/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |::|.||.||||:.:.:||.|..||  ..:.:|:|:|...:...::.|::|||:|||.|.||..:
Zfish    15 KIVLVGDVGVGKTCVVQRFKTGIFI--EKQGNTIGVDFTMKTLEIHGKRVKLQIWDTAGQERFRT 77

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTY-AENAKIFICGNKSDL-DGREPEVSDEE 137
            :|.|||:.|.|||:.:.:...|:|.|:.:.:.|:..| ..|....:.|||.|| :.||..:.|.:
Zfish    78 ITQSYYRSANGAIITYDITKKATFLSVPKWMEDVKKYGGSNIVPLLIGNKCDLSESREVPLEDAQ 142

  Fly   138 VEAFCEQCHSL--ISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSG 200
            ..|     |.|  :|| .:||.:..:.|:|.|..::.:|:..:...|         |..:...|.
Zfish   143 TMA-----HQLDFVSA-IETSAKDSSNVDEAFNKMASELILRHGGPM---------FTENVTDSF 192

  Fly   201 AATNEEDAS---SCGC 213
            ..|.::.|.   .|||
Zfish   193 KLTGKDVAGEGWGCGC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 59/169 (35%)
Rab 10..172 CDD:206640 58/165 (35%)
rab43NP_001038812.1 P-loop_NTPase 11..175 CDD:304359 58/167 (35%)
RAB 14..178 CDD:197555 59/170 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.