DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Rab2a

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_113906.1 Gene:Rab2a / 65158 RGDID:68323 Length:212 Species:Rattus norvegicus


Alignment Length:216 Identity:77/216 - (35%)
Similarity:112/216 - (51%) Gaps:23/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            |.|:.||.|||||.|..:|....|....|  .|:|::...|..:::.||||||:|||.|.|...|
  Rat     8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHD--LTMGVEFGARMITIDGKQIKLQIWDTAGQESFRS 70

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138
            :|.|||:.|.||:||:.:....:|:.|:..|.|...:: .|..|.:.||||||:.|. ||..||.
  Rat    71 ITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRR-EVKKEEG 134

  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSG--- 200
            |||..: |.||  ..:||.::.:.|||.|         .|.:|...:.::...|.::..::|   
  Rat   135 EAFARE-HGLI--FMETSAKTASNVEEAF---------INTAKEIYEKIQEGVFDINNEANGIKI 187

  Fly   201 ----AATNEEDASSCGCXQLG 217
                ||||.....:.|. |.|
  Rat   188 GPQHAATNASHGGNQGGQQAG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 66/166 (40%)
Rab 10..172 CDD:206640 66/162 (41%)
Rab2aNP_113906.1 Required for interaction with PRKCI. /evidence=ECO:0000250 2..19 6/10 (60%)
Rab2 3..170 CDD:206658 68/176 (39%)
RAB 7..170 CDD:197555 68/176 (39%)
Effector region. /evidence=ECO:0000250 35..43 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..212 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.