DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and RRAD

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001122322.1 Gene:RRAD / 6236 HGNCID:10446 Length:308 Species:Homo sapiens


Alignment Length:180 Identity:46/180 - (25%)
Similarity:78/180 - (43%) Gaps:13/180 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            ||:|.|..|||||:|.|.|..   :.|.......|..: ||...|:.::..|.::|....:....
Human    93 KVLLLGAPGVGKSALARIFGG---VEDGPEAEAAGHTY-DRSIVVDGEEASLMVYDIWEQDGGRW 153

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDI--VTYAENAKIFICGNKSDLDGREPEVSDEE 137
            :........:..::|:::.:..||...|:..:.:  ....::..|.:.|||||| .|..|||.:|
Human   154 LPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDL-VRSREVSVDE 217

  Fly   138 VEAFCEQCHSLISATY-KTSCRSGAGVEEMFRDISRQLVHANRSKMELQA 186
            ..|    |..:....: :||......|:.:|..:.|| :...|...|..|
Human   218 GRA----CAVVFDCKFIETSAALHHNVQALFEGVVRQ-IRLRRDSKEANA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 43/168 (26%)
Rab 10..172 CDD:206640 41/164 (25%)
RRADNP_001122322.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88
RGK 92..308 CDD:206715 46/180 (26%)
RAS 92..252 CDD:214541 43/168 (26%)
Calmodulin-binding 278..297
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.