DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and RRAGD

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_067067.1 Gene:RRAGD / 58528 HGNCID:19903 Length:400 Species:Homo sapiens


Alignment Length:275 Identity:56/275 - (20%)
Similarity:95/275 - (34%) Gaps:77/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KQKVILCGDYGVGKSSL----FRRFATN--TFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDT 66
            |.:::|.|....||||:    |.:.:.|  .|:..|::        |.||...|...:..|:||.
Human    62 KPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNK--------ICREDVSNSSFVNFQIWDF 118

  Fly    67 GGMERVASVTSSYYKFAEG-AILVFALDNAASFHSLSQHLLDIVTYAE------NAKIFICGNKS 124
            .|.......|..|.....| ..|:|.:|:...:......|...||.|.      |.::||    .
Human   119 PGQIDFFDPTFDYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFI----H 179

  Fly   125 DLDGREPE------------VSDEEVEAFCEQC-----------HSLISATYKTSCR-------- 158
            .:||...:            .:|:..:|..|:.           ||:..|..|...:        
Human   180 KVDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTL 244

  Fly   159 --------SGAGVEE--MFRDISRQLVHANRSKMELQALEHKSFQVDTA----------SSGAAT 203
                    |.:|:|:  :|..:|:..:..:.:.:::|..|.....:|..          ..||.|
Human   245 ENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDMQTYELCCDMIDVVIDISCIYGLKEDGAGT 309

  Fly   204 NEEDASSCGCXQLGN 218
             ..|..|... :|.|
Human   310 -PYDKESTAIIKLNN 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 45/219 (21%)
Rab 10..172 CDD:206640 44/215 (20%)
RRAGDNP_067067.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
RagC_like 64..238 CDD:206745 40/185 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.