DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and Rab37

DIOPT Version :10

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_067386.3 Gene:Rab37 / 58222 MGIID:1929945 Length:223 Species:Mus musculus


Alignment Length:210 Identity:66/210 - (31%)
Similarity:111/210 - (52%) Gaps:29/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            ||:|.||.||||:....:|....|::.| ..:|:|:|..::..:|:..::|||:|||.|.||..|
Mouse    31 KVMLLGDSGVGKTCFLIQFKDGAFLSGT-FIATVGIDFRNKVVTVDGARVKLQIWDTAGQERFRS 94

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138
            ||.:||:.|:..:|::.:.|.:||.::...|.:|..||: :..|.:.|||:|:.. |..:..|:.
Mouse    95 VTHAYYRDAQALLLLYDITNQSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADVSS-ERVIRSEDG 158

  Fly   139 EAFCEQCHSLISATY-----KTSCRSGAGVEEMFRDISRQLVH-ANRSKMELQALEHKSFQV-DT 196
            |....:        |     :||.::|..||..|..|:::|.: |.|..      :..|||: |.
Mouse   159 ETLARE--------YGVPFMETSAKTGMNVELAFLAIAKELKYRAGRQP------DEPSFQIRDY 209

  Fly   197 ASSGAATNEEDASSC 211
            ..|     ::..|||
Mouse   210 VES-----QKKRSSC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 Rab 10..172 CDD:206640 55/167 (33%)
Rab37NP_067386.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Rab26 31..220 CDD:206695 66/210 (31%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 52..67 4/15 (27%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 85..102 10/16 (63%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.