DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX6 and RAB25

DIOPT Version :9

Sequence 1:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_065120.2 Gene:RAB25 / 57111 HGNCID:18238 Length:213 Species:Homo sapiens


Alignment Length:208 Identity:65/208 - (31%)
Similarity:106/208 - (50%) Gaps:9/208 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
            ||:|.|:.||||::|..||..|.|  ..|.::|:|::...|...:....:|.|:|||.|:||..:
Human    14 KVVLIGESGVGKTNLLSRFTRNEF--SHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAGLERYRA 76

  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138
            :||:||:.|.||:|||.|....::..:.:.|.::..:|| ...:.:.|||||| .:..||..||.
Human    77 ITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDL-SQAREVPTEEA 140

  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGAAT 203
            ..|.|....|.   .:||......||..|..:.:: :.|..||....::...:..:.:|.:|...
Human   141 RMFAENNGLLF---LETSALDSTNVELAFETVLKE-IFAKVSKQRQNSIRTNAITLGSAQAGQEP 201

  Fly   204 NEEDASSCGCXQL 216
            ...:..:| |..|
Human   202 GPGEKRAC-CISL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX6NP_001261219.1 RAB 10..176 CDD:197555 57/166 (34%)
Rab 10..172 CDD:206640 57/162 (35%)
RAB25NP_065120.2 Rab11_like 11..174 CDD:206660 57/166 (34%)
Effector region. /evidence=ECO:0000250 41..49 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.