Sequence 1: | NP_001261219.1 | Gene: | RabX6 / 38084 | FlyBaseID: | FBgn0035155 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001313450.1 | Gene: | rab1aa / 566914 | ZFINID: | ZDB-GENE-090312-110 | Length: | 201 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 74/196 - (37%) |
---|---|---|---|
Similarity: | 109/196 - (55%) | Gaps: | 11/196 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
Fly 75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138
Fly 139 EAFCEQCHSLISATYKTSCRSGAGVEEMF----RDISRQLVHANRSKMELQALEHKSFQVDTASS 199
Fly 200 G 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX6 | NP_001261219.1 | RAB | 10..176 | CDD:197555 | 67/170 (39%) |
Rab | 10..172 | CDD:206640 | 67/166 (40%) | ||
rab1aa | NP_001313450.1 | Rab1_Ypt1 | 7..172 | CDD:206661 | 67/167 (40%) |
RAB | 9..172 | CDD:197555 | 67/167 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24073 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |