Sequence 1: | NP_001261219.1 | Gene: | RabX6 / 38084 | FlyBaseID: | FBgn0035155 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062636.2 | Gene: | Rrad / 56437 | MGIID: | 1930943 | Length: | 307 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 50/202 - (24%) |
---|---|---|---|
Similarity: | 84/202 - (41%) | Gaps: | 24/202 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74
Fly 75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDI--VTYAENAKIFICGNKSDLDGREPEVSDEE 137
Fly 138 VEAFCEQCHSLISATY-KTSCRSGAGVEEMFRDISRQLVHANRSKMELQALEHKSFQVDTASSGA 201
Fly 202 ATNEEDA 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RabX6 | NP_001261219.1 | RAB | 10..176 | CDD:197555 | 44/168 (26%) |
Rab | 10..172 | CDD:206640 | 42/164 (26%) | ||
Rrad | NP_062636.2 | RGK | 91..307 | CDD:206715 | 50/202 (25%) |
Calmodulin-binding. /evidence=ECO:0000250 | 277..296 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |